| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RNA-directed RNA polymerase |
|---|
| Ligand | BDBM50186185 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_366543 (CHEMBL871397) |
|---|
| IC50 | 7±n/a nM |
|---|
| Citation |  Rockway, TW; Zhang, R; Liu, D; Betebenner, DA; McDaniel, KF; Pratt, JK; Beno, D; Montgomery, D; Jiang, WW; Masse, S; Kati, WM; Middleton, T; Molla, A; Maring, CJ; Kempf, DJ Inhibitors of HCV NS5B polymerase: synthesis and structure-activity relationships of N-1-benzyl and N-1-[3-methylbutyl]-4-hydroxy-1,8-naphthyridon-3-yl benzothiadiazine analogs containing substituents on the aromatic ring. Bioorg Med Chem Lett16:3833-8 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RNA-directed RNA polymerase |
|---|
| Name: | RNA-directed RNA polymerase |
|---|
| Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25173.95 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | Q8JXU8 |
|---|
| Residue: | 229 |
|---|
| Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
|---|
| BDBM50186185 |
|---|
| n/a |
|---|
| Name | BDBM50186185 |
|---|
| Synonyms: | CHEMBL211408 | N-{3-[4-hydroxy-1-(3-methyl-butyl)-2-oxo-1,2-dihydro-[1,8]naphthyridin-3-yl]-1,1-dioxo-1,4-dihydro-1lambda*6*-benzo[1,2,4]thiadiazin-7-yl}-benzenesulfonamide | N-{3-[4-hydroxy-1-(3-methyl-butyl)-2-oxo-1,2-dihydro-quinolin-3-yl]-1,1-dioxo-1,4-dihydro-1lambda*6*-benzo[1,2,4]thiadiazin-7-yl}-benzenesulfonamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25N5O6S2 |
|---|
| Mol. Mass. | 567.637 |
|---|
| SMILES | CC(C)CCn1c2ncccc2c(O)c(C2=Nc3ccc(NS(=O)(=O)c4ccccc4)cc3S(=O)(=O)N2)c1=O |t:16| |
|---|
| Structure | 
|
|---|
Search and Browse
