Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase TXK
LigandBDBM50186460
Substrate/Competitorn/a
Meas. Tech.ChEMBL_377338
IC50 11000±n/a nM
Citation Das JFurch JALiu CMoquin RVLin JSpergel SHMcIntyre KWShuster DJO'Day KDPenhallow BHung CYDoweyko AMKamath AZhang HMarathe PKanner SBLin TADodd JHBarrish JCWityak J Discovery and SAR of 2-amino-5-(thioaryl)thiazoles as potent and selective Itk inhibitors. Bioorg Med Chem Lett 16:3706-12 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase TXK
Name:Tyrosine-protein kinase TXK
Synonyms:PTK4 | Protein-tyrosine kinase 4 | RLK | Resting lymphocyte kinase | TXK | Tyrosine-protein kinase TXK (TXK)
Type:Protein
Mol. Mass.:61268.80
Organism:Homo sapiens (Human)
Description:P42681
Residue:527
Sequence:
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50186460
n/a
NameBDBM50186460
Synonyms:CHEMBL209148 | N-(5-(5-(1-acetylpiperazine-4-carbonyl)-4-methoxy-2-methylphenylthio)thiazol-2-yl)-4-((3,3-dimethylbutan-2-ylamino)methyl)benzamide
TypeSmall organic molecule
Emp. Form.C32H41N5O4S2
Mol. Mass.623.829
SMILESCOc1cc(C)c(Sc2cnc(NC(=O)c3ccc(CNC(C)C(C)(C)C)cc3)s2)cc1C(=O)N1CCN(CC1)C(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: