Reaction Details |
| Report a problem with these data |
Target | Proteasome subunit beta type-5 |
---|
Ligand | BDBM50410902 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_353294 (CHEMBL861973) |
---|
Ki | 130±n/a nM |
---|
Citation | Rydzewski, RM; Burrill, L; Mendonca, R; Palmer, JT; Rice, M; Tahilramani, R; Bass, KE; Leung, L; Gjerstad, E; Janc, JW; Pan, L Optimization of subsite binding to the beta5 subunit of the human 20S proteasome using vinyl sulfones and 2-keto-1,3,4-oxadiazoles: syntheses and cellular properties of potent, selective proteasome inhibitors. J Med Chem49:2953-68 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Proteasome subunit beta type-5 |
---|
Name: | Proteasome subunit beta type-5 |
Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
Type: | Protein |
Mol. Mass.: | 28480.96 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 263 |
Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
BDBM50410902 |
---|
n/a |
---|
Name | BDBM50410902 |
Synonyms: | CHEMBL205687 |
Type | Small organic molecule |
Emp. Form. | C31H40N6O7S |
Mol. Mass. | 640.75 |
SMILES | C[C@H](NC(=O)[C@H](CC(=O)NCC(C)(C)C)NS(=O)(=O)c1ccc(C)cc1)C(=O)NC(C)(C)C(=O)c1nnc(o1)-c1ccccc1 |
Structure |
|