| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-2 |
|---|
| Ligand | BDBM50410904 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_353295 (CHEMBL861974) |
|---|
| Ki | >900000±n/a nM |
|---|
| Citation |  Rydzewski, RM; Burrill, L; Mendonca, R; Palmer, JT; Rice, M; Tahilramani, R; Bass, KE; Leung, L; Gjerstad, E; Janc, JW; Pan, L Optimization of subsite binding to the beta5 subunit of the human 20S proteasome using vinyl sulfones and 2-keto-1,3,4-oxadiazoles: syntheses and cellular properties of potent, selective proteasome inhibitors. J Med Chem49:2953-68 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-2 |
|---|
| Name: | Proteasome subunit beta type-2 |
|---|
| Synonyms: | 20S proteasome | PSB2_HUMAN | PSMB2 | Proteasome Macropain subunit |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 22837.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_1294233 |
|---|
| Residue: | 201 |
|---|
| Sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RIIDKNGIHDLDNISFPKQGS
|
|
|
|---|
| BDBM50410904 |
|---|
| n/a |
|---|
| Name | BDBM50410904 |
|---|
| Synonyms: | CHEMBL377532 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H46N6O8S |
|---|
| Mol. Mass. | 698.829 |
|---|
| SMILES | COC[C@H](NC(=O)[C@H](CC(=O)NCC(C)(C)C)NS(=O)(=O)c1ccc(C)cc1)C(=O)N[C@@H](CC(C)C)C(=O)c1nnc(o1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
