| Reaction Details |
|---|
 | Report a problem with these data |
| Target | S-ribosylhomocysteine lyase |
|---|
| Ligand | BDBM50148771 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_353579 (CHEMBL861694) |
|---|
| Ki | 720000±n/a nM |
|---|
| Citation |  Shen, G; Rajan, R; Zhu, J; Bell, CE; Pei, D Design and synthesis of substrate and intermediate analogue inhibitors of S-ribosylhomocysteinase. J Med Chem49:3003-11 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| S-ribosylhomocysteine lyase |
|---|
| Name: | S-ribosylhomocysteine lyase |
|---|
| Synonyms: | LUXS_ECOLI | luxS | ygaG |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 19410.45 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | ChEMBL_353579 |
|---|
| Residue: | 171 |
|---|
| Sequence: | MPLLDSFTVDHTRMEAPAVRVAKTMNTPHGDAITVFDLRFCVPNKEVMPERGIHTLEHLF
AGFMRNHLNGNGVEIIDISPMGCRTGFYMSLIGTPDEQRVADAWKAAMEDVLKVQDQNQI
PELNVYQCGTYQMHSLQEAQDIARSILERDVRINSNEELALPKEKLQELHI
|
|
|
|---|
| BDBM50148771 |
|---|
| n/a |
|---|
| Name | BDBM50148771 |
|---|
| Synonyms: | (2R,3R)-N,2,3,4-TETRAHYDROXYBUTANAMIDE | (2R,4R)-2,3,4,N-Tetrahydroxy-butyramide | CHEMBL117442 | D-erythronohydroxamic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C4H9NO5 |
|---|
| Mol. Mass. | 151.118 |
|---|
| SMILES | OC[C@@H](O)[C@@H](O)C(=O)NO |
|---|
| Structure | 
|
|---|
Search and Browse
