| Reaction Details |
|---|
 | Report a problem with these data |
| Target | S-ribosylhomocysteine lyase |
|---|
| Ligand | BDBM50186743 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_353578 (CHEMBL861693) |
|---|
| Ki | 70000±n/a nM |
|---|
| Citation |  Shen, G; Rajan, R; Zhu, J; Bell, CE; Pei, D Design and synthesis of substrate and intermediate analogue inhibitors of S-ribosylhomocysteinase. J Med Chem49:3003-11 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| S-ribosylhomocysteine lyase |
|---|
| Name: | S-ribosylhomocysteine lyase |
|---|
| Synonyms: | LUXS_BACSU | luxS | ytjB |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 17709.00 |
|---|
| Organism: | Bacillus subtilis |
|---|
| Description: | ChEMBL_764478 |
|---|
| Residue: | 157 |
|---|
| Sequence: | MPSVESFELDHNAVVAPYVRHCGVHKVGTDGVVNKFDIRFCQPNKQAMKPDTIHTLEHLL
AFTIRSHAEKYDHFDIIDISPMGCQTGYYLVVSGEPTSAEIVDLLEDTMKEAVEITEIPA
ANEKQCGQAKLHDLEGAKRLMRFWLSQDKEELLKVFG
|
|
|
|---|
| BDBM50186743 |
|---|
| n/a |
|---|
| Name | BDBM50186743 |
|---|
| Synonyms: | CHEMBL383729 | S-ribosylcysteine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H15NO6S |
|---|
| Mol. Mass. | 253.273 |
|---|
| SMILES | N[C@H](CSC[C@H]1O[C@@H](O)[C@H](O)[C@@H]1O)C(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
