Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetN-formyl peptide receptor 2
LigandBDBM21692
Substrate/Competitorn/a
Meas. Tech.ChEMBL_376306
EC50 44±n/a nM
Citation Bürli RWXu HZou XMuller KGolden JFrohn MAdlam MPlant MHWong MMcElvain MRegal KViswanadhan VNTagari PHungate R Potent hFPRL1 (ALXR) agonists as potential anti-inflammatory agents. Bioorg Med Chem Lett 16:3713-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
N-formyl peptide receptor 2
Name:N-formyl peptide receptor 2
Synonyms:ALXR, FPRL1, FPR2 | FMLP-related receptor I FMLP-R-I | Formyl Peptide Receptor-Like 1 | HM63 | LXA4 receptor | Lipoxin A4 receptor | Lipoxin A4 receptor (LXA4) | RFP | hFPRL
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:38968.35
Organism:Homo sapiens (Human)
Description:n/a
Residue:351
Sequence:
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21692
n/a
NameBDBM21692
Synonyms:1-(4-chlorophenyl)-3-[1-methyl-3-oxo-2-phenyl-5-(propan-2-yl)-2,3-dihydro-1H-pyrazol-4-yl]urea | 1-(4-chlorophenyl)-3-[1-methyl-5-(1-methylethyl)-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazol-4-yl]urea | CHEMBL379761 | Pyrazolone, 1
TypeSmall organic molecule
Emp. Form.C20H21ClN4O2
Mol. Mass.384.859
SMILESCC(C)c1c(NC(=O)Nc2ccc(Cl)cc2)c(=O)n(-c2ccccc2)n1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: