| Reaction Details |
|---|
 | Report a problem with these data |
| Target | RNA-directed RNA polymerase |
|---|
| Ligand | BDBM50187221 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_356302 (CHEMBL869357) |
|---|
| IC50 | 240±n/a nM |
|---|
| Citation |  Gopalsamy, A; Chopra, R; Lim, K; Ciszewski, G; Shi, M; Curran, KJ; Sukits, SF; Svenson, K; Bard, J; Ellingboe, JW; Agarwal, A; Krishnamurthy, G; Howe, AY; Orlowski, M; Feld, B; O'Connell, J; Mansour, TS Discovery of proline sulfonamides as potent and selective hepatitis C virus NS5b polymerase inhibitors. Evidence for a new NS5b polymerase binding site. J Med Chem49:3052-5 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| RNA-directed RNA polymerase |
|---|
| Name: | RNA-directed RNA polymerase |
|---|
| Synonyms: | Hepatitis C virus NS5B RNA-dependent RNA polymerase | NS5B protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25173.95 |
|---|
| Organism: | Hepatitis C virus |
|---|
| Description: | Q8JXU8 |
|---|
| Residue: | 229 |
|---|
| Sequence: | RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
|
|
|
|---|
| BDBM50187221 |
|---|
| n/a |
|---|
| Name | BDBM50187221 |
|---|
| Synonyms: | (4S)-3-[(3,5-dichloro-2-hydroxyphenyl)sulfonyl]-1,3-thiazolidine-4-carboxylic acid | CHEMBL207911 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H9Cl2NO5S2 |
|---|
| Mol. Mass. | 358.218 |
|---|
| SMILES | OC(=O)[C@@H]1CSCN1S(=O)(=O)c1cc(Cl)cc(Cl)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
