Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor
LigandBDBM50188420
Substrate/Competitorn/a
Meas. Tech.ChEMBL_362910
Ki 1.29±n/a nM
Citation Tsotinis AVlachou MPapahatjis DPCalogeropoulou TNikas SPGarratt PJPiccio VVonhoff SDavidson KTeh MTSugden D Mapping the melatonin receptor. 7. Subtype selective ligands based on beta-substituted N-acyl-5-methoxytryptamines and beta-substituted N-acyl-5-methoxy-1-methyltryptamines. J Med Chem 49:3509-19 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor
Name:Melatonin receptor
Synonyms:MTNR1B | Mel-1B-R | Mel1b melatonin receptor | Melatonin 1B | Melatonin receptor | Melatonin receptor type 1B | Melatonin receptor type 2 (MT2)
Type:Enzyme
Mol. Mass.:40203.54
Organism:Homo sapiens (Human)
Description:P49286
Residue:362
Sequence:
MSENGSFANCCEAGGWAVRPGWSGAGSARPSRTPRPPWVAPALSAVLIVTTAVDVVGNLL
VILSVLRNRKLRNAGNLFLVSLALADLVVAFYPYPLILVAIFYDGWALGEEHCKASAFVM
GLSVIGSVFNITAIAINRYCYICHSMAYHRIYRRWHTPLHICLIWLLTVVALLPNFFVGS
LEYDPRIYSCTFIQTASTQYTAAVVVIHFLLPIAVVSFCYLRIWVLVLQARRKAKPESRL
CLKPSDLRSFLTMFVVFVIFAICWAPLNCIGLAVAINPQEMAPQIPEGLFVTSYLLAYFN
SCLNAIVYGLLNQNFRREYKRILLALWNPRHCIQDASKGSHAEGLQSPAPPIIGVQHQAD
AL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50188420
n/a
NameBDBM50188420
Synonyms:CHEMBL208307 | N-(2-[5-methoxy-1-methyl-1H-indol-3-yl]-2-methylpropyl)acetamide
TypeSmall organic molecule
Emp. Form.C16H22N2O2
Mol. Mass.274.3581
SMILESCOc1ccc2n(C)cc(c2c1)C(C)(C)CNC(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: