Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCAMK2A
LigandBDBM2579
Substrate/Competitorn/a
Meas. Tech.ChEMBL_389607
IC50>1±n/a nM
Citation Lin XMurray JMRico ACWang MXChu DTZhou YDel Rosario MKaufman SMa SFang ECrawford KJefferson AB Discovery of 2-pyrimidyl-5-amidothiophenes as potent inhibitors for AKT: synthesis and SAR studies. Bioorg Med Chem Lett 16:4163-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
CAMK2A
Name:CAMK2A
Synonyms:CaM kinase II | CaM kinase II alpha | Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2a)
Type:Enzyme Catalytic Domain
Mol. Mass.:54093.63
Organism:Homo sapiens (Human)
Description:gi_25952118
Residue:478
Sequence:
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEA
ISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIH
LMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPSVLPH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM2579
n/a
NameBDBM2579
Synonyms:(2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-29-oxa-1,7,17-triazaoctacyclo[12.12.2.1^{2,6}.0^{7,28}.0^{8,13}.0^{15,19}.0^{20,27}.0^{21,26}]nonacosa-8(13),9,11,14(28),15(19),20(27),21(26),22,24-nonaen-16-one | CHEMBL388978 | Staurosporin, 4 | Staurosporine | Staurosporine, 8 | US9206188, Staurosporine | US9226923, Staurosporine
TypeSmall organic molecule
Emp. Form.C28H26N4O3
Mol. Mass.466.531
SMILESCN[C@@H]1C[C@H]2O[C@@](C)([C@@H]1OC)n1c3ccccc3c3c4CNC(=O)c4c4c5ccccc5n2c4c13 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: