| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocyte-stimulating hormone receptor |
|---|
| Ligand | BDBM50189023 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_395992 (CHEMBL910337) |
|---|
| Ki | 4.3±n/a nM |
|---|
| Citation |  Tian, X; Mishra, RK; Switzer, AG; Hu, XE; Kim, N; Mazur, AW; Ebetino, FH; Wos, JA; Crossdoersen, D; Pinney, BB; Farmer, JA; Sheldon, RJ Design and synthesis of potent and selective 1,3,4-trisubstituted-2-oxopiperazine based melanocortin-4 receptor agonists. Bioorg Med Chem Lett16:4668-73 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocyte-stimulating hormone receptor |
|---|
| Name: | Melanocyte-stimulating hormone receptor |
|---|
| Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34717.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01726 |
|---|
| Residue: | 317 |
|---|
| Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
|---|
| BDBM50189023 |
|---|
| n/a |
|---|
| Name | BDBM50189023 |
|---|
| Synonyms: | (S)-2-((S)-4-((R)-3-(4-fluorophenyl)-2-(piperazin-1-yl)propanoyl)-3-(3-guanidinopropyl)-2-oxopiperazin-1-yl)-N-methyl-3-(naphthalen-2-yl)propanamide | CHEMBL214410 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H45FN8O3 |
|---|
| Mol. Mass. | 644.782 |
|---|
| SMILES | CNC(=O)[C@H](Cc1ccc2ccccc2c1)N1CCN([C@@H](CCCNC(N)=N)C1=O)C(=O)[C@@H](Cc1ccc(F)cc1)N1CCNCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
