Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsoprenylcysteine carboxyl methyltransferase
LigandBDBM50189243
Substrate/Competitorn/a
Meas. Tech.ChEMBL_380404
IC50 23000±n/a nM
Citation Donelson JLHodges HBMacdougall DDHenriksen BSHrycyna CAGibbs RA Amide-substituted farnesylcysteine analogs as inhibitors of human isoprenylcysteine carboxyl methyltransferase. Bioorg Med Chem Lett 16:4420-3 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Isoprenylcysteine carboxyl methyltransferase
Name:Isoprenylcysteine carboxyl methyltransferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:31943.26
Organism:Homo sapiens (Human)
Description:ChEMBL_956034
Residue:284
Sequence:
MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYR
PPRYQIAIRACFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLS
LDSFLLNHSLEYTVAALSSWLEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFT
AGSNFNHVVQNEKSDTHTLVTSGVYAWFRHPSYVGWFYWSIGTQVMLCNPICGVSYALTV
WRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGVKVDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50189243
n/a
NameBDBM50189243
Synonyms:(R)-2-(3,5-dichlorobenzamido)-3-(3,7,11-trimethyldodeca-2,6,10-trienylthio)propanoic acid | CHEMBL209435
TypeSmall organic molecule
Emp. Form.C25H33Cl2NO3S
Mol. Mass.498.505
SMILES[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#6]\[#6](-[#6])=[#6]\[#6]-[#16]-[#6]-[#6@H](-[#7]-[#6](=O)-c1cc(Cl)cc(Cl)c1)-[#6](-[#8])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: