Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM50190082
Substrate/Competitorn/a
Meas. Tech.ChEMBL_393313
Ki 2±n/a nM
Citation Su JTang HMcKittrick BABurnett DAZhang HSmith-Torhan AFawzi ALachowicz J Modification of the clozapine structure by parallel synthesis. Bioorg Med Chem Lett 16:4548-53 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50190082
n/a
NameBDBM50190082
Synonyms:CHEMBL379942 | N-[2,8-dichloro-11-(4-methyl-piperazin-1-yl)-dibenzo[b,e][1,4]diazepin-5-yl]-2-methyl-benzamide
TypeSmall organic molecule
Emp. Form.C26H25Cl2N5O
Mol. Mass.494.416
SMILESCN1CCN(CC1)C1=Nc2cc(Cl)ccc2N(NC(=O)c2ccccc2C)c2ccc(Cl)cc12 |t:8|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: