| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Ligand | BDBM50190559 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_373621 (CHEMBL869761) |
|---|
| Ki | 32000±n/a nM |
|---|
| Citation |  Nguyen, C; Ruda, GF; Schipani, A; Kasinathan, G; Leal, I; Musso-Buendia, A; Kaiser, M; Brun, R; Ruiz-Pérez, LM; Sahlberg, BL; Johansson, NG; Gonzalez-Pacanowska, D; Gilbert, IH Acyclic nucleoside analogues as inhibitors of Plasmodium falciparum dUTPase. J Med Chem49:4183-95 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Name: | Deoxyuridine 5'-triphosphate nucleotidohydrolase |
|---|
| Synonyms: | dUTP pyrophosphatase |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 19574.43 |
|---|
| Organism: | Plasmodium falciparum |
|---|
| Description: | Q8II92 |
|---|
| Residue: | 173 |
|---|
| Sequence: | MHLKIVCLSDEVREMYKNHKTHHEGDSGLDLFIVKDEVLKPKSTTFVKLGIKAIALQYKS
NYYYKCEKSENKKKDDDKSNIVNTSFLLFPRSSISKTPLRLANSIGLIDAGYRGEIIAAL
DNTSDQEYHIKKNDKLVQLVSFTGEPLSFELVEELDETSRGEGGFGSTSNNKY
|
|
|
|---|
| BDBM50190559 |
|---|
| n/a |
|---|
| Name | BDBM50190559 |
|---|
| Synonyms: | 1-(6-benzoyloxyhexyl)uracil | CHEMBL211066 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H20N2O4 |
|---|
| Mol. Mass. | 316.3517 |
|---|
| SMILES | O=C(OCCCCCCn1ccc(=O)[nH]c1=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
