Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetdUTP pyrophosphatase
LigandBDBM50190564
Substrate/Competitorn/a
Meas. Tech.ChEMBL_373621
Ki 1300±n/a nM
Citation Nguyen CRuda GFSchipani AKasinathan GLeal IMusso-Buendia AKaiser MBrun RRuiz-Pérez LMSahlberg BLJohansson NGGonzalez-Pacanowska DGilbert IH Acyclic nucleoside analogues as inhibitors of Plasmodium falciparum dUTPase. J Med Chem 49:4183-95 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
dUTP pyrophosphatase
Name:dUTP pyrophosphatase
Synonyms:Putative deoxyuridine 5''-triphosphate nucleotidohydrolase
Type:Protein
Mol. Mass.:19574.43
Organism:Plasmodium falciparum
Description:Q8II92
Residue:173
Sequence:
MHLKIVCLSDEVREMYKNHKTHHEGDSGLDLFIVKDEVLKPKSTTFVKLGIKAIALQYKS
NYYYKCEKSENKKKDDDKSNIVNTSFLLFPRSSISKTPLRLANSIGLIDAGYRGEIIAAL
DNTSDQEYHIKKNDKLVQLVSFTGEPLSFELVEELDETSRGEGGFGSTSNNKY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50190564
n/a
NameBDBM50190564
Synonyms:1-[4-acetyloxy-3-(tritylaminomethyl)butyl]uracil | CHEMBL208621
TypeSmall organic molecule
Emp. Form.C30H31N3O4
Mol. Mass.497.5848
SMILESCC(=O)OCC(CCn1ccc(=O)[nH]c1=O)CNC(c1ccccc1)(c1ccccc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: