| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50191056 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_401405 (CHEMBL870427) |
|---|
| IC50 | 42±n/a nM |
|---|
| Citation |  Petrov, RR; Vardanyan, RS; Lee, YS; Ma, SW; Davis, P; Begay, LJ; Lai, JY; Porreca, F; Hruby, VJ Synthesis and evaluation of 3-aminopropionyl substituted fentanyl analogues for opioid activity. Bioorg Med Chem Lett16:4946-50 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50191056 |
|---|
| n/a |
|---|
| Name | BDBM50191056 |
|---|
| Synonyms: | (S)-2-amino-3-(4-hydroxy-phenyl)-N-((R)-1-{[((S)-1-{2-[(1-phenethyl-piperidin-4-yl)-phenyl-carbamoyl]-ethylcarbamoyl}-2-phenyl-ethylcarbamoyl)-methyl]-carbamoyl}-ethyl)-propionamide | CHEMBL214022 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C45H55N7O6 |
|---|
| Mol. Mass. | 789.9615 |
|---|
| SMILES | C[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)NCCC(=O)N(C1CCN(CCc2ccccc2)CC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
