Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepatitis C virus NS5B RNA-dependent RNA polymerase
LigandBDBM50191511
Substrate/Competitorn/a
Meas. Tech.ChEMBL_376990
IC50 170±n/a nM
Citation Hirashima SSuzuki TIshida TNoji SYata SAndo IKomatsu MIkeda SHashimoto H Benzimidazole derivatives bearing substituted biphenyls as hepatitis C virus NS5B RNA-dependent RNA polymerase inhibitors: structure-activity relationship studies and identification of a potent and highly selective inhibitor JTK-109. J Med Chem 49:4721-36 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Hepatitis C virus NS5B RNA-dependent RNA polymerase
Name:Hepatitis C virus NS5B RNA-dependent RNA polymerase
Synonyms:NS5B protein
Type:Protein
Mol. Mass.:25173.95
Organism:Hepatitis C virus
Description:Q8JXU8
Residue:229
Sequence:
RTEEAIYQCCDLDPQARVAIRSLTERLYVGGPLTNSRGENCGYRRRASGVLTTSCGNTLT
CYIKAQAACRAAGRQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPP
QPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIM
FAPTLWVRMIMLTHFFSVLIARDQLEQALDCEIYGACYSIEPLLPPIIQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50191511
n/a
NameBDBM50191511
Synonyms:2-{4-[4'-chloro-4-(2-oxo-pyrrolidin-1-yl)-biphenyl-2-ylmethoxy]-2-fluoro-phenyl}-1-cyclohexyl-1H-benzoimidazole-5-carboxylic acid | 2-{4-[4'-chloro-4-(2-oxopyrrolidin-1-yl)biphenyl-2-ylmethoxy]-2-fluorophenyl}-1-cyclohexyl-1H-benzimidazole-5-carboxylic acid | CHEMBL210297
TypeSmall organic molecule
Emp. Form.C37H33ClFN3O4
Mol. Mass.638.127
SMILESOC(=O)c1ccc2n(C3CCCCC3)c(nc2c1)-c1ccc(OCc2cc(ccc2-c2ccc(Cl)cc2)N2CCCC2=O)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: