Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X receptor (LXR alpha AND LXR beta)
LigandBDBM50192128
Substrate/Competitorn/a
Meas. Tech.ChEMBL_406040
IC50 50±n/a nM
Citation Panday NBenz JBlum-Kaelin DBourgeaux VDehmlow HHartman PKuhn BRatni HWarot XWright MB Synthesis and evaluation of anilinohexafluoroisopropanols as activators/modulators of LXRalpha and beta. Bioorg Med Chem Lett 16:5231-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver X receptor (LXR alpha AND LXR beta)
Name:Liver X receptor (LXR alpha AND LXR beta)
Synonyms:Liver X receptor beta (NR1H2) | Liver X, LXR beta | Oxysterols receptor LXR-beta
Type:Protein
Mol. Mass.:50978.79
Organism:Homo sapiens (Human)
Description:P55055
Residue:460
Sequence:
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQESQSQ
SQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50192128
n/a
NameBDBM50192128
Synonyms:2-(4-(((2-(3-chlorophenyl)-5-methyloxazol-4-yl)methyl)(2,2,2-trifluoroethyl)amino)phenyl)-1,1,1,3,3,3-hexafluoropropan-2-ol | CHEMBL386603
TypeSmall organic molecule
Emp. Form.C22H16ClF9N2O2
Mol. Mass.546.813
SMILESCc1oc(nc1CN(CC(F)(F)F)c1ccc(cc1)C(O)(C(F)(F)F)C(F)(F)F)-c1cccc(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: