| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein 5 |
|---|
| Ligand | BDBM50192463 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_381686 (CHEMBL869162) |
|---|
| Ki | 3±n/a nM |
|---|
| Citation |  McDonnell, PA; Constantine, KL; Goldfarb, V; Johnson, SR; Sulsky, R; Magnin, DR; Robl, JA; Caulfield, TJ; Parker, RA; Taylor, DS; Adam, LP; Metzler, WJ; Mueller, L; Farmer, BT NMR structure of a potent small molecule inhibitor bound to human keratinocyte fatty acid-binding protein. J Med Chem49:5013-7 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein 5 |
|---|
| Name: | Fatty acid-binding protein 5 |
|---|
| Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 15164.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01469 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
|---|
| BDBM50192463 |
|---|
| n/a |
|---|
| Name | BDBM50192463 |
|---|
| Synonyms: | 2-(2,3-bis(2-chlorobenzyloxy)phenyl)acetic acid | CHEMBL212860 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H18Cl2O4 |
|---|
| Mol. Mass. | 417.282 |
|---|
| SMILES | OC(=O)Cc1cccc(OCc2ccccc2Cl)c1OCc1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
