Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVitamin K-dependent protein C
LigandBDBM50193230
Substrate/Competitorn/a
Meas. Tech.ChEMBL_381887
IC50 250±n/a nM
Citation De Nanteuil GGloanec PBéguin SGiesen PLHemker HCMennecier PRupin AVerbeuren TJ Low molecular weight activated protein C inhibitors as a potential treatment for hemophilic disorders. J Med Chem 49:5047-50 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vitamin K-dependent protein C
Name:Vitamin K-dependent protein C
Synonyms:Activated protein C cofactor | Anticoagulant protein C | Apolipoprotein H | Autoprothrombin IIA | Blood coagulation factor XIV | Coagulation factor V | Coagulation factor V heavy chain | Coagulation factor V light chain | Endothelial protein C receptor | Proaccelerin, labile factor | Vitamin K-dependent protein C precursor
Type:Enzyme
Mol. Mass.:52067.73
Organism:Homo sapiens (Human)
Description:n/a
Residue:461
Sequence:
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50193230
n/a
NameBDBM50193230
Synonyms:CHEMBL215639 | {(R)-1-[2-(4-carbamimidoyl-benzylcarbamoyl)-2,3-dihydro-1H-cyclopenta[a]naphthalen-2-ylcarbamoyl]-2-methyl-propylamino}-acetic acid
TypeSmall organic molecule
Emp. Form.C29H33N5O4
Mol. Mass.515.6034
SMILESCC(C)[C@@H](NCC(O)=O)C(=O)NC1(Cc2ccc3ccccc3c2C1)C(=O)NCc1ccc(cc1)C(N)=N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: