| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocortin receptor 5 |
|---|
| Ligand | BDBM50193830 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_422338 (CHEMBL908723) |
|---|
| IC50 | 0.800000±n/a nM |
|---|
| Citation |  Cain, JP; Mayorov, AV; Cai, M; Wang, H; Tan, B; Chandler, K; Lee, Y; Petrov, RR; Trivedi, D; Hruby, VJ Design, synthesis, and biological evaluation of a new class of small molecule peptide mimetics targeting the melanocortin receptors. Bioorg Med Chem Lett16:5462-7 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocortin receptor 5 |
|---|
| Name: | Melanocortin receptor 5 |
|---|
| Synonyms: | MC-2 | MC5-R | MC5R | MC5R_HUMAN | Melanocortin MC5 | Melanocortin receptor (M4 and M5) | Melanocortin receptor 5 | Melanocortin receptor 5 (MC5R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36612.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P33032 |
|---|
| Residue: | 325 |
|---|
| Sequence: | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
|
|
|
|---|
| BDBM50193830 |
|---|
| n/a |
|---|
| Name | BDBM50193830 |
|---|
| Synonyms: | 1-((3S,8aS)-3-benzyl-hexahydropyrrolo[1,2-a]pyrazin-2(1H)-yl)-3-(1H-indol-3-yl)propan-1-one | CHEMBL387169 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H29N3O |
|---|
| Mol. Mass. | 387.5173 |
|---|
| SMILES | O=C(CCc1c[nH]c2ccccc12)N1C[C@@H]2CCCN2C[C@@H]1Cc1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
