| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 1 |
|---|
| Ligand | BDBM50193971 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_424262 (CHEMBL908414) |
|---|
| IC50 | 100±n/a nM |
|---|
| Citation |  Nie, H; Widdowson, KL; Palovich, MR; Fu, W; Elliott, JD; Bryan, DL; Burman, M; Schmidt, DB; Foley, JJ; Sarau, HM; Busch-Petersen, J N,N'-Diarylcyanoguanidines as antagonists of the CXCR2 and CXCR1 chemokine receptors. Bioorg Med Chem Lett16:5513-6 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 1 |
|---|
| Name: | C-X-C chemokine receptor type 1 |
|---|
| Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39803.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25024 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
|---|
| BDBM50193971 |
|---|
| n/a |
|---|
| Name | BDBM50193971 |
|---|
| Synonyms: | 3-{[[(2-bromophenyl)amino](cyanoimino)methyl]amino}-2-hydroxy-N,N-dimethyl-6-(trifluoromethyl)benzenesulfonamide | CHEMBL218665 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H15BrF3N5O3S |
|---|
| Mol. Mass. | 506.297 |
|---|
| SMILES | CN(C)S(=O)(=O)c1c(O)c(ccc1C(F)(F)F)N=C(NC#N)Nc1ccccc1Br |w:17.17| |
|---|
| Structure | 
|
|---|
Search and Browse
