| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 2 |
|---|
| Ligand | BDBM50193985 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_424261 (CHEMBL908413) |
|---|
| IC50 | 4±n/a nM |
|---|
| Citation |  Nie, H; Widdowson, KL; Palovich, MR; Fu, W; Elliott, JD; Bryan, DL; Burman, M; Schmidt, DB; Foley, JJ; Sarau, HM; Busch-Petersen, J N,N'-Diarylcyanoguanidines as antagonists of the CXCR2 and CXCR1 chemokine receptors. Bioorg Med Chem Lett16:5513-6 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 2 |
|---|
| Name: | C-X-C chemokine receptor type 2 |
|---|
| Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 40767.88 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25025 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
|---|
| BDBM50193985 |
|---|
| n/a |
|---|
| Name | BDBM50193985 |
|---|
| Synonyms: | 3-{[[(2-bromophenyl)amino](cyanoimino)methyl]amino}-6-fluoro-2-hydroxy-N,N-dimethylbenzenesulfonamide | CHEMBL375393 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H15BrFN5O3S |
|---|
| Mol. Mass. | 456.289 |
|---|
| SMILES | CN(C)S(=O)(=O)c1c(F)ccc(N=C(NC#N)Nc2ccccc2Br)c1O |w:12.11| |
|---|
| Structure | 
|
|---|
Search and Browse
