Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase kinase kinase 8
LigandBDBM50195004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_424645
IC50 180±n/a nM
Citation Hu YGreen NGavrin LKJanz KKaila NLi HQThomason JRCuozzo JWHall JPHsu SNickerson-Nutter CTelliez JBLin LLTam S Inhibition of Tpl2 kinase and TNFalpha production with quinoline-3-carbonitriles for the treatment of rheumatoid arthritis. Bioorg Med Chem Lett 16:6067-72 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase kinase kinase 8
Name:Mitogen-activated protein kinase kinase kinase 8
Synonyms:C-COT | COT proto-oncogene serine/threonine-protein kinase | Cancer Osaka thyroid oncogene | Mitogen-activated protein kinase kinase kinase 8 | Tpl-2 | Tumor Progression Loci-2 Kinase (COT) | Tumor progression locus 2
Type:Serine/threonine-protein kinase
Mol. Mass.:52916.89
Organism:Homo sapiens (Human)
Description:n/a
Residue:467
Sequence:
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG
MRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50195004
n/a
NameBDBM50195004
Synonyms:(S)-4-(3-chloro-4-fluorophenylamino)-6-((1-ethylpyrrolidin-2-yl)methylamino)quinoline-3-carbonitrile | CHEMBL426924
TypeSmall organic molecule
Emp. Form.C23H23ClFN5
Mol. Mass.423.914
SMILESCCN1CCC[C@H]1CNc1ccc2ncc(C#N)c(Nc3ccc(F)c(Cl)c3)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: