| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 1 |
|---|
| Ligand | BDBM50195456 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_424982 (CHEMBL910739) |
|---|
| Kd | 13000±n/a nM |
|---|
| Citation |  Chen, F; Hancock, CN; Macias, AT; Joh, J; Still, K; Zhong, S; MacKerell, AD; Shapiro, P Characterization of ATP-independent ERK inhibitors identified through in silico analysis of the active ERK2 structure. Bioorg Med Chem Lett16:6281-7 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 1 |
|---|
| Name: | Mitogen-activated protein kinase 1 |
|---|
| Synonyms: | ERK2 | ERT1 | Extracellular signal-regulated kinase 2 | Extracellular signal-regulated kinase 2 (ERK-2) | Extracellular signal-regulated kinase 2 (ERK2) | MAP Kinase 2/ERK2 | MAPK 2 | MAPK1 | MK01_HUMAN | Mitogen activated kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK-2) | Mitogen-activated protein kinase 1 (ERK2) | Mitogen-activated protein kinase 2 | PRKM1 | PRKM2 | p42-MAPK |
|---|
| Type: | Ser/Thr Protein Kinase |
|---|
| Mol. Mass.: | 41392.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P28482 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
|---|
| BDBM50195456 |
|---|
| n/a |
|---|
| Name | BDBM50195456 |
|---|
| Synonyms: | CHEMBL221271 | N'-nitro-2-((5-(3-nitrophenyl)furan-2-yl)methylene)hydrazinecarboximidamide | N'-nitro-2-{[5-(3-nitrophenyl)-2-furyl]methylene}hydrazinecarboximidamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H10N6O5 |
|---|
| Mol. Mass. | 318.245 |
|---|
| SMILES | NC(N=NCc1ccc(o1)-c1cccc(c1)[N+]([O-])=O)=N[N+]([O-])=O |w:19.21,3.3| |
|---|
| Structure | 
|
|---|
Search and Browse
