| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 2 |
|---|
| Ligand | BDBM50198838 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_432836 (CHEMBL914104) |
|---|
| EC50 | 530±n/a nM |
|---|
| Citation |  Foss, FW; Snyder, AH; Davis, MD; Rouse, M; Okusa, MD; Lynch, KR; Macdonald, TL Synthesis and biological evaluation of gamma-aminophosphonates as potent, subtype-selective sphingosine 1-phosphate receptor agonists and antagonists. Bioorg Med Chem15:663-77 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 2 |
|---|
| Name: | Sphingosine 1-phosphate receptor 2 |
|---|
| Synonyms: | EDG5 | S1P2 | S1PR2 | S1PR2_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor Edg-5 | Sphingosine-1-phosphate receptor 2 | ndothelial differentiation G-protein coupled receptor 5 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 38883.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Membranes isolated from S1P2-transfected CHO cells were used in ligand binding assay. |
|---|
| Residue: | 353 |
|---|
| Sequence: | MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
|
|
|
|---|
| BDBM50198838 |
|---|
| n/a |
|---|
| Name | BDBM50198838 |
|---|
| Synonyms: | CHEMBL228049 | [3-amino-4-(4-octylphenoxy)-butyl]-phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H28NO4P |
|---|
| Mol. Mass. | 329.3716 |
|---|
| SMILES | CCCCCCc1ccc(OC[C@H](N)CCP(O)(O)=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
