Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor alpha (PPAR alpha)
LigandBDBM50200411
Substrate/Competitorn/a
Meas. Tech.ChEMBL_453683
IC50 175±n/a nM
Citation Cantin LDLiang SOgutu HIwuagwu CIBoakye KBullock WHBurns MClark RClaus TdelaCruz FEDaly MEhrgott FJJohnson JSKeiper CLivingston JNSchoenleber RWShapiro JTown CYang LTsutsumi MMa X Indanylacetic acid derivatives carrying aryl-pyridyl and aryl-pyrimidinyl tail groups--new classes of PPAR gamma/delta and PPAR alpha/gamma/delta agonists. Bioorg Med Chem Lett 17:1056-61 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Name:Peroxisome proliferator-activated receptor
Synonyms:Nuclear receptor subfamily 1 group C member 1 | PPAR alpha/gamma | PPAR-alpha | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor
Type:Enzyme
Mol. Mass.:52222.08
Organism:Homo sapiens (Human)
Description:Q07869
Residue:468
Sequence:
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSC
PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFV
IHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDI
FLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50200411
n/a
NameBDBM50200411
Synonyms:(S)-2-(5-(3-((2-(4-ethylphenyl)-5-methylpyrimidin-4-yl)(methyl)amino)propoxy)-2,3-dihydro-1H-inden-1-yl)acetic acid | CHEMBL239352
TypeSmall organic molecule
Emp. Form.C28H33N3O3
Mol. Mass.459.5799
SMILESCCc1ccc(cc1)-c1ncc(C)c(n1)N(C)CCCOc1ccc2[C@H](CC(O)=O)CCc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: