| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50200949 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_422734 (CHEMBL854830) |
|---|
| Ki | 23±n/a nM |
|---|
| Citation |  Whiting, M; Tripp, JC; Lin, YC; Lindstrom, W; Olson, AJ; Elder, JH; Sharpless, KB; Fokin, VV Rapid discovery and structure-activity profiling of novel inhibitors of human immunodeficiency virus type 1 protease enabled by the copper(I)-catalyzed synthesis of 1,2,3-triazoles and their further functionalization. J Med Chem49:7697-710 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50200949 |
|---|
| n/a |
|---|
| Name | BDBM50200949 |
|---|
| Synonyms: | CHEMBL262738 | cyclopentyl (2S,3S)-3-[4-([4-(5-chloro-2-methylphenyl)piperazin-1-yl]methyl)-1H-1,2,3-triazol-1-yl]-1,4-diphenylbutan-2-ylcarbamate |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H43ClN6O2 |
|---|
| Mol. Mass. | 627.219 |
|---|
| SMILES | Cc1ccc(Cl)cc1N1CCN(Cc2cn(nn2)[C@@H](Cc2ccccc2)[C@H](Cc2ccccc2)NC(=O)OC2CCCC2)CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
