Reaction Details |
| Report a problem with these data |
Target | Bcl-2-like protein 2 |
---|
Ligand | BDBM50200964 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_422737 (CHEMBL909833) |
---|
Ki | 30810±n/a nM |
---|
Citation | Doshi, JM; Tian, D; Xing, C Structure-activity relationship studies of ethyl 2-amino-6-bromo-4-(1-cyano-2-ethoxy-2-oxoethyl)-4H-chromene-3-carboxylate (HA 14-1), an antagonist for antiapoptotic Bcl-2 proteins to overcome drug resistance in cancer. J Med Chem49:7731-9 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-like protein 2 |
---|
Name: | Bcl-2-like protein 2 |
Synonyms: | Apoptosis regulator Bcl-W | B2CL2_HUMAN | BCL-W | BCL2L2 | BCLW | Bcl-2-like protein 2 | Bcl2-L-2 | KIAA0271 |
Type: | Protein |
Mol. Mass.: | 20742.61 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 193 |
Sequence: | MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
|
|
|
BDBM50200964 |
---|
n/a |
---|
Name | BDBM50200964 |
Synonyms: | CHEMBL219234 | ethyl 2-amino-6-cyclopentyl-4-(1-cyano-2-ethoxy-2-oxoethyl)-4H-chromene-3-carboxylate |
Type | Small organic molecule |
Emp. Form. | C22H26N2O5 |
Mol. Mass. | 398.4522 |
SMILES | CCOC(=O)C(C#N)C1C(C(=O)OCC)C(=N)Oc2ccc(cc12)C1CCCC1 |
Structure |
|