Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxypeptidase B
LigandBDBM50201436
Substrate/Competitorn/a
Meas. Tech.ChEMBL_453905
IC50>30000±n/a nM
Citation Islam IBryant JMay KMohan RYuan SKent LMorser JZhao LVergona RWhite KAdler MWhitlow MBuckman BO 3-Mercaptopropionic acids as efficacious inhibitors of activated thrombin activatable fibrinolysis inhibitor (TAFIa). Bioorg Med Chem Lett 17:1349-54 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxypeptidase B
Name:Carboxypeptidase B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:47371.10
Organism:Sus scrofa
Description:ChEMBL_453905
Residue:416
Sequence:
MLAFLILVTVTLASAHHSGEHFEGEKVFRVNVEDENDISLLHELASTRQIDFWKPDSVTQ
IKPHSTVDFRVKAEDILAVEDFLEQNELQYEVLINNLRSVLEAQFDSRVRTTGHSYEKYN
NWETIEAWTKQVTSENPDLISRTAIGTTFLGNNIYLLKVGKPGPNKPAIFMDCGFHAREW
ISHAFCQWFVREAVLTYGYESHMTEFLNKLDFYVLPVLNIDGYIYTWTKNRMWRKTRSTN
AGTTCIGTDPNRNFDAGWCTTGASTDPCDETYCGSAAESEKETKALADFIRNNLSSIKAY
LTIHSYSQMILYPYSYDYKLPENNAELNNLAKAAVKELATLYGTKYTYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDKGRYGFILPESQIQATCEETMLAIKYVTNYVLGHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50201436
n/a
NameBDBM50201436
Synonyms:2-(1-(2-aminoacetyl)piperidin-4-yl)-3-mercaptopropanoic acid | CHEMBL245786
TypeSmall organic molecule
Emp. Form.C10H18N2O3S
Mol. Mass.246.327
SMILESNCC(=O)N1CCC(CC1)C(CS)C(O)=O |w:10.11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: