Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBDKRB2
LigandBDBM50202411
Substrate/Competitorn/a
Meas. Tech.ChEMBL_423710
IC50>10000±n/a nM
Citation Kuduk SDDi Marco CNChang RKWood MRSchirripa KMKim JJWai JMDiPardo RMMurphy KLRansom RWHarrell CMReiss DRHolahan MACook JHess JFSain NUrban MOTang CPrueksaritanont TPettibone DJBock MG Development of orally bioavailable and CNS penetrant biphenylaminocyclopropane carboxamide bradykinin B1 receptor antagonists. J Med Chem 50:272-82 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BDKRB2
Name:Bradykinin B2 receptor
Synonyms:B2 BRADYKININ | B2 bradykinin receptor | B2R | BK-2 receptor | Bradykinin B2 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:44467.17
Organism:Homo sapiens (Human)
Description:B2 BRADYKININ BDKRB2 HUMAN::P30411
Residue:391
Sequence:
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50202411
n/a
NameBDBM50202411
Synonyms:CHEMBL218267 | methyl 4'-({[(1-{[chloro(difluoro)acetyl]amino}cyclopropyl)-carbonyl]amino}methyl)-3,3'-difluoro-1,1'-biphenyl-2-carboxylate
TypeSmall organic molecule
Emp. Form.C21H17ClF4N2O4
Mol. Mass.472.817
SMILESCOC(=O)c1c(F)cccc1-c1ccc(CNC(=O)C2(CC2)NC(=O)C(F)(F)Cl)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: