Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50202412
Substrate/Competitorn/a
Meas. Tech.ChEMBL_423682
Ki 7.3±n/a nM
Citation Kuduk SDDi Marco CNChang RKWood MRSchirripa KMKim JJWai JMDiPardo RMMurphy KLRansom RWHarrell CMReiss DRHolahan MACook JHess JFSain NUrban MOTang CPrueksaritanont TPettibone DJBock MG Development of orally bioavailable and CNS penetrant biphenylaminocyclopropane carboxamide bradykinin B1 receptor antagonists. J Med Chem 50:272-82 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39519.62
Organism:Oryctolagus cuniculus
Description:ChEMBL_796432
Residue:352
Sequence:
MASQGPLELQPSNQSQLAPPNATSCSGAPDAWDLLHRLLPTFIIAIFTLGLLGNSFVLSV
FLLARRRLSVAEIYLANLAASDLVFVLGLPFWAENVRNQFDWPFGAALCRIVNGVIKANL
FISIFLVVAISQDRYSVLVHPMASRRGRRRRQAQATCALIWLAGGLLSTPTFVLRSVRAV
PELNVSACILLLPHEAWHWLRMVELNLLGFLLPLAAILFFNCHILASLRRRGERVPSRCG
GPRDSKSTALILTLVASFLVCWAPYHFFAFLECLWQVHAIGGCFWEEFTDLGLQLSNFSA
FVNSCLNPVIYVFVGRLFRTKVWELCQQCSPRSLAPVSSSRRKEMLWGFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50202412
n/a
NameBDBM50202412
Synonyms:3-Chloro-3'-fluoro-4'-((R)-1-{[1-(2,2,2-trifluoro-acetylamino)-cyclopropanecarbonyl]-amino}-ethyl)-biphenyl-2-carboxylic acid methyl ester | CHEMBL232943 | methyl 3-chloro-3'-fluoro-4'-{(1R)-1-[({1-[(trifluoroacetyl)amino]cyclopropyl}carbonyl)amino]ethyl}-1,1'-biphenyl-2-carboxylate
TypeSmall organic molecule
Emp. Form.C22H19ClF4N2O4
Mol. Mass.486.844
SMILESCOC(=O)c1c(Cl)cccc1-c1ccc([C@@H](C)NC(=O)C2(CC2)NC(=O)C(F)(F)F)c(F)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: