Reaction Details |
| Report a problem with these data |
Target | B1 bradykinin receptor |
---|
Ligand | BDBM50202409 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_423671 (CHEMBL912896) |
---|
IC50 | 0.89±n/a nM |
---|
Citation | Kuduk, SD; Di Marco, CN; Chang, RK; Wood, MR; Schirripa, KM; Kim, JJ; Wai, JM; DiPardo, RM; Murphy, KL; Ransom, RW; Harrell, CM; Reiss, DR; Holahan, MA; Cook, J; Hess, JF; Sain, N; Urban, MO; Tang, C; Prueksaritanont, T; Pettibone, DJ; Bock, MG Development of orally bioavailable and CNS penetrant biphenylaminocyclopropane carboxamide bradykinin B1 receptor antagonists. J Med Chem50:272-82 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
B1 bradykinin receptor |
---|
Name: | B1 bradykinin receptor |
Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
Type: | Enzyme |
Mol. Mass.: | 40508.87 |
Organism: | Homo sapiens (Human) |
Description: | P46663 |
Residue: | 353 |
Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
BDBM50202409 |
---|
n/a |
---|
Name | BDBM50202409 |
Synonyms: | CHEMBL218605 | N-{(1R)-1-[3,3'-difluoro-2'-(3-methyl-1,2,4-oxadiazol-5-yl)-1,1'-biphenyl-4-yl]ethyl}-1-[(trifluoroacetyl)amino]cyclopropanecarboxamide |
Type | Small organic molecule |
Emp. Form. | C23H19F5N4O3 |
Mol. Mass. | 494.414 |
SMILES | C[C@@H](NC(=O)C1(CC1)NC(=O)C(F)(F)F)c1ccc(cc1F)-c1cccc(F)c1-c1nc(C)no1 |r| |
Structure |
|