Reaction Details |
| Report a problem with these data |
Target | Melanin-concentrating hormone receptor 1 |
---|
Ligand | BDBM50202677 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_421700 (CHEMBL854908) |
---|
IC50 | 4±n/a nM |
---|
Citation | Iyengar, RR; Lynch, JK; Mulhern, MM; Judd, AS; Freeman, JC; Gao, J; Souers, AJ; Zhao, G; Wodka, D; Doug Falls, H; Brodjian, S; Dayton, BD; Reilly, RM; Swanson, S; Su, Z; Martin, RL; Leitza, ST; Houseman, KA; Diaz, G; Collins, CA; Sham, HL; Kym, PR An evaluation of 3,4-methylenedioxy phenyl replacements in the aminopiperidine chromone class of MCHr1 antagonists. Bioorg Med Chem Lett17:874-8 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Melanin-concentrating hormone receptor 1 |
---|
Name: | Melanin-concentrating hormone receptor 1 |
Synonyms: | G-protein coupled receptor 24 | GPR24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCHR | MCHR-1 | MCHR1 | MCHR1_HUMAN | Melanin Concentrating Hormone 1 | Melanin-Concentrating Hormone Receptor 1 (MCH1R) | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1 (MCH-1) | Melanin-concentrating hormone receptor 1 (MCH1) | Melanin-concentrating hormone receptor 1 (MCHR-1) | Melanin-concentrating hormone receptor 1 (MCHR1) | SLC-1 | SLC1 | Somatostatin receptor-like protein |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 45976.27 |
Organism: | Homo sapiens (Human) |
Description: | Membranes from CHO-K1 cells stably expressing human MCH1R were used in assays. |
Residue: | 422 |
Sequence: | MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPNCGACAPGQGGRRWRLPQPAWVEGSSARL
WEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTIC
LLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHF
GETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALS
FISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRI
LQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVY
LYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESK
GT
|
|
|
BDBM50202677 |
---|
n/a |
---|
Name | BDBM50202677 |
Synonyms: | CHEMBL216104 | N-(1-(benzo[b]thiophen-5-ylmethyl)piperidin-4-yl)-7-fluoro-4-oxo-4H-chromene-2-carboxamide |
Type | Small organic molecule |
Emp. Form. | C24H21FN2O3S |
Mol. Mass. | 436.499 |
SMILES | Fc1ccc2c(c1)oc(cc2=O)C(=O)NC1CCN(Cc2ccc3sccc3c2)CC1 |
Structure |
|