| Reaction Details |
|---|
 | Report a problem with these data |
| Target | B1 bradykinin receptor |
|---|
| Ligand | BDBM50203206 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_425211 (CHEMBL855157) |
|---|
| Ki | 17±n/a nM |
|---|
| Citation |  D'Amico, DC; Aya, T; Human, J; Fotsch, C; Chen, JJ; Biswas, K; Riahi, B; Norman, MH; Willoughby, CA; Hungate, R; Reider, PJ; Biddlecome, G; Lester-Zeiner, D; Staden, CV; Johnson, E; Kamassah, A; Arik, L; Wang, J; Viswanadhan, VN; Groneberg, RD; Zhan, J; Suzuki, H; Toro, A; Mareska, DA; Clarke, DE; Harvey, DM; Burgess, LE; Laird, ER; Askew, B; Ng, G Identification of a nonpeptidic and conformationally restricted bradykinin B1 receptor antagonist with anti-inflammatory activity. J Med Chem50:607-10 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| B1 bradykinin receptor |
|---|
| Name: | B1 bradykinin receptor |
|---|
| Synonyms: | B1 BRADYKININ | B1 bradykinin receptor | B1R | BDKRB1 | BK-1 receptor | BKRB1_HUMAN | BRADYB1 | Bradykinin B1 receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40508.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P46663 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
|
|
|
|---|
| BDBM50203206 |
|---|
| n/a |
|---|
| Name | BDBM50203206 |
|---|
| Synonyms: | (R)-3-(naphthalene-3-sulfonamido)-3-phenyl-N-((R)-1-(4-(piperidin-1-ylmethyl)phenyl)ethyl)propanamide | CHEMBL221925 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H37N3O3S |
|---|
| Mol. Mass. | 555.73 |
|---|
| SMILES | C[C@@H](NC(=O)C[C@@H](NS(=O)(=O)c1ccc2ccccc2c1)c1ccccc1)c1ccc(CN2CCCCC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
