Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSphingosine 1-phosphate receptor 3
LigandBDBM50203766
Substrate/Competitorn/a
Meas. Tech.ChEMBL_425682
IC50>20000±n/a nM
Citation Koide YUemoto KHasegawa TSada TMurakami ATakasugi HSakurai AMochizuki NTakahashi ANishida A Pharmacophore-based design of sphingosine 1-phosphate-3 receptor antagonists that include a 3,4-dialkoxybenzophenone scaffold. J Med Chem 50:442-54 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sphingosine 1-phosphate receptor 3
Name:Sphingosine 1-phosphate receptor Edg-5/Sphingosine 1-phosphate receptor Edg-3
Synonyms:EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42278.13
Organism:Homo sapiens (Human)
Description:Q99500
Residue:378
Sequence:
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50203766
n/a
NameBDBM50203766
Synonyms:(4R)-2-(3-((4-chloro-2-isopropyl-6-methylphenoxy)methyl)-4-methoxyphenyl)thiazolidine-4-carboxylic acid | CHEMBL218126
TypeSmall organic molecule
Emp. Form.C22H26ClNO4S
Mol. Mass.435.964
SMILESCOc1ccc(cc1COc1c(C)cc(Cl)cc1C(C)C)C1N[C@@H](CS1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: