| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cannabinoid receptor 2 |
|---|
| Ligand | BDBM50205166 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_438314 (CHEMBL887422) |
|---|
| IC50 | 284.7±n/a nM |
|---|
| Citation |  Armstrong, HE; Galka, A; Lin, LS; Lanza, TJ; Jewell, JP; Shah, SK; Guthikonda, R; Truong, Q; Chang, LL; Quaker, G; Colandrea, VJ; Tong, X; Wang, J; Xu, S; Fong, TM; Shen, CP; Lao, J; Chen, J; Shearman, LP; Stribling, DS; Rosko, K; Strack, A; Ha, S; Van der Ploeg, L; Goulet, MT; Hagmann, WK Substituted acyclic sulfonamides as human cannabinoid-1 receptor inverse agonists. Bioorg Med Chem Lett17:2184-7 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cannabinoid receptor 2 |
|---|
| Name: | Cannabinoid receptor 2 |
|---|
| Synonyms: | CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 39690.94 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P34972 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
|
|
|
|---|
| BDBM50205166 |
|---|
| n/a |
|---|
| Name | BDBM50205166 |
|---|
| Synonyms: | CHEMBL231636 | N-((2S,3S)-4-(4-chlorophenyl)-3-(3-cyanophenyl)butan-2-yl)-2-methyl-2-(5-(trifluoromethyl)pyridin-3-yloxy)propanamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H25ClF3N3O2 |
|---|
| Mol. Mass. | 515.955 |
|---|
| SMILES | C[C@H](NC(=O)C(C)(C)Oc1cncc(c1)C(F)(F)F)[C@@H](Cc1ccc(Cl)cc1)c1cccc(c1)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
