Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid DP receptor
LigandBDBM50205275
Substrate/Competitorn/a
Meas. Tech.ChEMBL_425870
Ki 0.570000±n/a nM
Citation Sturino CFO'Neill GLachance NBoyd MBerthelette CLabelle MLi LRoy BScheigetz JTsou NAubin YBateman KPChauret NDay SHLévesque JFSeto CSilva JHTrimble LACarriere MCDenis DGreig GKargman SLamontagne SMathieu MCSawyer NSlipetz DAbraham WMJones TMcAuliffe MPiechuta HNicoll-Griffith DAWang ZZamboni RYoung RNMetters KM Discovery of a potent and selective prostaglandin D2 receptor antagonist, [(3R)-4-(4-chloro-benzyl)-7-fluoro-5-(methylsulfonyl)-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]-acetic acid (MK-0524). J Med Chem 50:794-806 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid DP receptor
Name:Prostanoid DP receptor
Synonyms:Prostaglandin D2 | Prostaglandin D2 receptor
Type:Enzyme
Mol. Mass.:40288.87
Organism:Homo sapiens (Human)
Description:Q13258
Residue:359
Sequence:
MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50205275
n/a
NameBDBM50205275
Synonyms:CHEMBL426559 | [(3R)-4-(4-chlorobenzyl)-7-fluoro-5-(methylsulfonyl)-1,2,3,4-tetrahydrocyclopenta[b]indol-3-yl]-acetic acid
TypeSmall organic molecule
Emp. Form.C21H19ClFNO4S
Mol. Mass.435.896
SMILESCS(=O)(=O)c1cc(F)cc2c3CC[C@H](CC(O)=O)c3n(Cc3ccc(Cl)cc3)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: