Reaction Details |
| Report a problem with these data |
Target | Cyclin-dependent kinase 1 |
---|
Ligand | BDBM50205472 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_442367 (CHEMBL892529) |
---|
Ki | 35±n/a nM |
---|
Citation | Chen, S; Chen, L; Le, NT; Zhao, C; Sidduri, A; Lou, JP; Michoud, C; Portland, L; Jackson, N; Liu, JJ; Konzelmann, F; Chi, F; Tovar, C; Xiang, Q; Chen, Y; Wen, Y; Vassilev, LT Synthesis and activity of quinolinyl-methylene-thiazolinones as potent and selective cyclin-dependent kinase 1 inhibitors. Bioorg Med Chem Lett17:2134-8 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cyclin-dependent kinase 1 |
---|
Name: | Cyclin-dependent kinase 1 |
Synonyms: | CDC2 | CDC28A | CDK1 | CDK1_HUMAN | CDKN1 | Cell division control protein 2 homolog | Cell division protein kinase 1 | Cyclin-dependent kinase 1 (CDK1) | P34CDC2 | p34 protein kinase |
Type: | Enzyme Subunit |
Mol. Mass.: | 34101.08 |
Organism: | Homo sapiens (Human) |
Description: | P06493 |
Residue: | 297 |
Sequence: | MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
|
|
|
BDBM50205472 |
---|
n/a |
---|
Name | BDBM50205472 |
Synonyms: | (5Z)-5-(quinolin-6-ylmethylidene)-2-[(thiophen-2-ylmethyl)amino]-1,3-thiazol-4(5H)-one | (Z)-5-(quinolin-6-ylmethylene)-2-(thiophen-2-ylmethylamino)thiazol-4(5H)-one | CHEMBL261644 | CHEMBL393929 |
Type | Small organic molecule |
Emp. Form. | C18H13N3OS2 |
Mol. Mass. | 351.445 |
SMILES | O=C1N=C(NCc2cccs2)SC1=Cc1ccc2ncccc2c1 |w:13.15,t:2| |
Structure |
|