| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cyclin-dependent kinase 4 |
|---|
| Ligand | BDBM50205472 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_442369 (CHEMBL892531) |
|---|
| Ki | >2000±n/a nM |
|---|
| Citation |  Chen, S; Chen, L; Le, NT; Zhao, C; Sidduri, A; Lou, JP; Michoud, C; Portland, L; Jackson, N; Liu, JJ; Konzelmann, F; Chi, F; Tovar, C; Xiang, Q; Chen, Y; Wen, Y; Vassilev, LT Synthesis and activity of quinolinyl-methylene-thiazolinones as potent and selective cyclin-dependent kinase 1 inhibitors. Bioorg Med Chem Lett17:2134-8 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cyclin-dependent kinase 4 |
|---|
| Name: | Cyclin-dependent kinase 4 |
|---|
| Synonyms: | CDK4 | CDK4_HUMAN | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3 |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 33731.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P11802 |
|---|
| Residue: | 303 |
|---|
| Sequence: | MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
|
|
|
|---|
| BDBM50205472 |
|---|
| n/a |
|---|
| Name | BDBM50205472 |
|---|
| Synonyms: | (5Z)-5-(quinolin-6-ylmethylidene)-2-[(thiophen-2-ylmethyl)amino]-1,3-thiazol-4(5H)-one | (Z)-5-(quinolin-6-ylmethylene)-2-(thiophen-2-ylmethylamino)thiazol-4(5H)-one | CHEMBL261644 | CHEMBL393929 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H13N3OS2 |
|---|
| Mol. Mass. | 351.445 |
|---|
| SMILES | O=C1N=C(NCc2cccs2)SC1=Cc1ccc2ncccc2c1 |w:13.15,t:2| |
|---|
| Structure | 
|
|---|
Search and Browse
