Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclooxygenase-1 (COX-1)
LigandBDBM50207446
Substrate/Competitorn/a
Meas. Tech.ChEMBL_461152
IC50>10000±n/a nM
Citation Blobaum ALMarnett LJ Structural and functional basis of cyclooxygenase inhibition. J Med Chem 50:1425-41 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclooxygenase-1 (COX-1)
Name:Cyclooxygenase
Synonyms:COX-1 | Cyclooxygenase-1 | Prostaglandin G/H synthase (cyclooxygenase)
Type:Enzyme
Mol. Mass.:68692.62
Organism:Homo sapiens (Human)
Description:P23219
Residue:599
Sequence:
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRF
LLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQ
YQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLY
ATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKF
DPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEA
LVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQEL
VGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICS
PEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207446
n/a
NameBDBM50207446
Synonyms:2-(2-(2-chloro-6-fluorophenylamino)-5-methylphenyl)acetic acid | CHEMBL404108
TypeSmall organic molecule
Emp. Form.C15H13ClFNO2
Mol. Mass.293.721
SMILESCc1ccc(Nc2c(F)cccc2Cl)c(CC(O)=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: