Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPeroxisome proliferator-activated receptor delta
LigandBDBM50207469
Substrate/Competitorn/a
Meas. Tech.ChEMBL_429020
EC50 300±n/a nM
Citation Sauerberg POlsen GSJeppesen LMogensen JPPettersson IJeppesen CBDaugaard JRGalsgaard EDYnddal LFleckner JPanajotova VPolivka ZPihera PHavranek MWulff EM Identification and synthesis of a novel selective partial PPARdelta agonist with full efficacy on lipid metabolism in vitro and in vivo. J Med Chem 50:1495-503 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Peroxisome proliferator-activated receptor delta
Name:Peroxisome proliferator-activated receptor delta
Synonyms:NUC1 | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR-beta | PPAR-delta
Type:PROTEIN
Mol. Mass.:49719.14
Organism:Mus musculus
Description:ChEMBL_1288931
Residue:440
Sequence:
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50207469
n/a
NameBDBM50207469
Synonyms:CHEMBL222880 | {4-[3,3-bis-(4-bromo-phenyl)-allylsulfanyl]-2-chloro-phenoxy}-acetic acid
TypeSmall organic molecule
Emp. Form.C23H17Br2ClO3S
Mol. Mass.568.705
SMILES[#8]-[#6](=O)-[#6]-[#8]-c1ccc(-[#16]-[#6]\[#6]=[#6](/c2ccc(Br)cc2)-c2ccc(Br)cc2)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: