Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin G
LigandBDBM50208228
Substrate/Competitorn/a
Meas. Tech.ChEMBL_429293
Ki 9500±n/a nM
Citation Greco MNHawkins MJPowell ETAlmond HRde Garavilla LHall JMinor LKWang YCorcoran TWDi Cera ECantwell AMSavvides SNDamiano BPMaryanoff BE Discovery of potent, selective, orally active, nonpeptide inhibitors of human mast cell chymase. J Med Chem 50:1727-30 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cathepsin G
Name:Cathepsin G
Synonyms:CG
Type:PROTEIN
Mol. Mass.:28860.08
Organism:Homo sapiens (Human)
Description:ChEMBL_1469016
Residue:255
Sequence:
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50208228
n/a
NameBDBM50208228
Synonyms:1-(5-chlorobenzo[b]thiophen-3-yl)-2-(naphthalen-2-ylamino)-2-oxoethylphosphonic acid | CHEMBL387130
TypeSmall organic molecule
Emp. Form.C20H15ClNO4PS
Mol. Mass.431.829
SMILESOP(O)(=O)C(C(=O)Nc1ccc2ccccc2c1)c1csc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: