Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
LigandBDBM50209519
Substrate/Competitorn/a
Meas. Tech.ChEMBL_455270
IC50 4±n/a nM
Citation Cantin LDMagnuson SGunn DBarucci NBreuhaus MBullock WHBurke JClaus THDaly MDecarr LGore-Willse AHoover-Litty HKumarasinghe ESLi YLiang SXLivingston JNLowinger TMacdougall MOgutu HOOlague AOtt-Morgan RSchoenleber RWTersteegen AWickens PZhang ZZhu JZhu LSweet LJ PDE-10A inhibitors as insulin secretagogues. Bioorg Med Chem Lett 17:2869-73 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
Name:cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
Synonyms:PDE10A | Phosphodiesterase 10 (PDE10) | Phosphodiesterase 10A
Type:Protein
Mol. Mass.:88412.52
Organism:Homo sapiens (Human)
Description:Q9Y233
Residue:779
Sequence:
MRIEERKSQHLTGLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAP
KEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYFLGEC
NNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGDERFPRGTGLE
SGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVC
RGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELY
SDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYT
GYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHR
IRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIGPFENMWPGIF
VYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTLFTD
LERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNI
FSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMM
TACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFY
NAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSVAQKAAASED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209519
n/a
NameBDBM50209519
Synonyms:4-[3-cyano-2-(2'-ethoxy-3-fluoro-biphenyl-4-yl)-6-fluoro-quinolin-4-ylamino]-butyric acid | CHEMBL246141
TypeSmall organic molecule
Emp. Form.C28H23F2N3O3
Mol. Mass.487.4973
SMILESCCOc1ccccc1-c1ccc(c(F)c1)-c1nc2ccc(F)cc2c(NCCCC(O)=O)c1C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: