Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBDKRB1
LigandBDBM50209744
Substrate/Competitorn/a
Meas. Tech.ChEMBL_434373
Ki 127±n/a nM
Citation Biswas KLi AChen JJD'Amico DCFotsch CHan NHuman JLiu QNorman MHRiahi BYuan CSuzuki HMareska DAZhan JClarke DEToro AGroneberg RDBurgess LELester-Zeiner DBiddlecome GManning BHArik LDong HHuang MKamassah ALoeloff RSun HHsieh FYKumar GNg GYHungate RWAskew BCJohnson E Potent nonpeptide antagonists of the bradykinin B1 receptor: structure-activity relationship studies with novel diaminochroman carboxamides. J Med Chem 50:2200-12 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
BDKRB1
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1R | BK-1 receptor | KB1 | Kinin B1 receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:38389.97
Organism:RAT
Description:B1 BRADYKININ BDKRB1 RAT::P97583
Residue:337
Sequence:
MASEVLLELQPSNRSLQAPANITSCESALEDWDLLYRVLPGFVITICFFGLLGNLLVLSF
FLLPWRQWWWQQRQRQQRLTIAEIYLANLAASDLVFVLGLPFWAENIGNRFNWPFGTDLC
RVVSGVIKANLFVSIFLVVAISQDRYRLLVYPMTSWGYRRRRQAQATCLLIWVAGGLLSI
PTFLLRSVKVVPDLNVSACILLFPHEAWHFARMVELNVLGFLLPVTAIIFFNYHILASLR
GQKEASRTRCGGPKGSKTTGLILTLVASFLVCWCPYHFFAFLDFLVQVRVIQDCSWKEIT
DLGLQLANFFAFVNSCLNPLIYVFAGRLLKTRVLGTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50209744
n/a
NameBDBM50209744
Synonyms:(R)-3-(4-fluorophenyl)-N-((R)-7-(piperidin-1-ylmethyl)-3,4-dihydro-2H-chromen-4-yl)-3-(3-(trifluoromethyl)phenylsulfonamido)propanamide | (R)-3-(4-fluorophenyl)-N-((R)-7-(piperidin-1-ylmethyl)chroman-4-yl)-3-(3-(trifluoromethyl)phenylsulfonamido)-propanamide | CHEMBL227713
TypeSmall organic molecule
Emp. Form.C31H33F4N3O4S
Mol. Mass.619.67
SMILESFc1ccc(cc1)[C@@H](CC(=O)N[C@@H]1CCOc2cc(CN3CCCCC3)ccc12)NS(=O)(=O)c1cccc(c1)C(F)(F)F |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: