Reaction Details |
| Report a problem with these data |
Target | Secreted chorismate mutase |
---|
Ligand | BDBM50209968 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_443914 (CHEMBL893079) |
---|
Ki | 17710±n/a nM |
---|
Citation | Agrawal, H; Kumar, A; Bal, NC; Siddiqi, MI; Arora, A Ligand based virtual screening and biological evaluation of inhibitors of chorismate mutase (Rv1885c) from Mycobacterium tuberculosis H37Rv. Bioorg Med Chem Lett17:3053-8 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Secreted chorismate mutase |
---|
Name: | Secreted chorismate mutase |
Synonyms: | Chorismate mutase (CM) | Chorismate mutase (MTB CM) | Chorismate mutase-related protein | SCMU_MYCTU |
Type: | Protein |
Mol. Mass.: | 21942.03 |
Organism: | Mycobacterium tuberculosis H37Rv |
Description: | n/a |
Residue: | 199 |
Sequence: | MLTRPREIYLATAVSIGILLSLIAPLGPPLARADGTSQLAELVDAAAERLEVADPVAAFK
WRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNP
ASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSL
YQRALTTATQSYCQALPPA
|
|
|
BDBM50209968 |
---|
n/a |
---|
Name | BDBM50209968 |
Synonyms: | (Z)-2-(4-chlorophenyl)-3-(4,5-dimethoxy-2-nitrophenyl)acrylic acid | CHEMBL232427 |
Type | Small organic molecule |
Emp. Form. | C17H14ClNO6 |
Mol. Mass. | 363.749 |
SMILES | COc1cc(\C=C(/C(O)=O)c2ccc(Cl)cc2)c(cc1OC)[N+]([O-])=O |
Structure |
|