Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM50210141
Substrate/Competitorn/a
Meas. Tech.ChEMBL_434482
Ki 5.32±n/a nM
Citation Liu TKapustin GEtzkorn FA Design and synthesis of a potent histone deacetylase inhibitor. J Med Chem 50:2003-6 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50210141
n/a
NameBDBM50210141
Synonyms:CHEMBL388195 | methyl (3S,6S,9S)-9-acetamido-6-[5-(hydroxycarbamoyl)pentyl]-5,8-dioxo-4,7-diazabicyclo[9.3.1]pentadeca-1(14),11(15),12-triene-3-carboxylate
TypeSmall organic molecule
Emp. Form.C23H32N4O7
Mol. Mass.476.5228
SMILESCOC(=O)[C@@H]1Cc2cccc(C[C@H](NC(C)=O)C(=O)N[C@@H](CCCCCC(=O)NO)C(=O)N1)c2
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: