Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBradykinin B1 receptor
LigandBDBM50212090
Substrate/Competitorn/a
Meas. Tech.ChEMBL_447237
Ki 0.68±n/a nM
Citation Kuduk SDDiPardo RMChang RKDi Marco CNMurphy KLRansom RWReiss DRTang CPrueksaritanont TPettibone DJBock MG Bradykinin B1 antagonists: biphenyl SAR studies in the cyclopropanecarboxamide series. Bioorg Med Chem Lett 17:3608-12 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bradykinin B1 receptor
Name:Bradykinin B1 receptor
Synonyms:B1 BRADYKININ | B1 bradykinin receptor | B1R | BK-1 receptor
Type:Enzyme
Mol. Mass.:40508.87
Organism:Homo sapiens (Human)
Description:P46663
Residue:353
Sequence:
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212090
n/a
NameBDBM50212090
Synonyms:5-chloro-3,3'-difluoro-4'-((R)-1-{[1-(2,2,2-trifluoro-acetylamino)-cyclopropanecarbonyl]-amino}-ethyl)-biphenyl-2-carboxylic acid methyl ester | CHEMBL231734
TypeSmall organic molecule
Emp. Form.C22H18ClF5N2O4
Mol. Mass.504.834
SMILESCOC(=O)c1c(F)cc(Cl)cc1-c1ccc([C@@H](C)NC(=O)C2(CC2)NC(=O)C(F)(F)F)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: