Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50212599
Substrate/Competitorn/a
Meas. Tech.ChEMBL_436673
Ki 52±n/a nM
Citation Raduner SBisson WAbagyan RAltmann KHGertsch J Self-assembling cannabinomimetics: supramolecular structures of N-alkyl amides. J Nat Prod 70:1010-5 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50212599
n/a
NameBDBM50212599
Synonyms:CHEMBL426912 | N-Isobutyl-(2E,4E)-dodecadienamide | N-Isobutyl-(2E,4E-dodeca-2,4-dienamide | dodeca-2E,4E-dienoic acid isobutylamide
TypeSmall organic molecule
Emp. Form.C16H29NO
Mol. Mass.251.4076
SMILESCCCCCCC\C=C\C=C\C(=O)NCC(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: