| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Fatty acid-binding protein 5 |
|---|
| Ligand | BDBM50150484 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_455935 (CHEMBL887936) |
|---|
| Ki | 248±n/a nM |
|---|
| Citation |  Sulsky, R; Magnin, DR; Huang, Y; Simpkins, L; Taunk, P; Patel, M; Zhu, Y; Stouch, TR; Bassolino-Klimas, D; Parker, R; Harrity, T; Stoffel, R; Taylor, DS; Lavoie, TB; Kish, K; Jacobson, BL; Sheriff, S; Adam, LP; Ewing, WR; Robl, JA Potent and selective biphenyl azole inhibitors of adipocyte fatty acid binding protein (aFABP). Bioorg Med Chem Lett17:3511-5 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Fatty acid-binding protein 5 |
|---|
| Name: | Fatty acid-binding protein 5 |
|---|
| Synonyms: | FABP5 | FABP5_HUMAN | Fatty acid binding protein epidermal | Fatty acid-binding protein 5 (FABP5) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 15164.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01469 |
|---|
| Residue: | 135 |
|---|
| Sequence: | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTL
KTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVEC
VMNNVTCTRIYEKVE
|
|
|
|---|
| BDBM50150484 |
|---|
| n/a |
|---|
| Name | BDBM50150484 |
|---|
| Synonyms: | (Z)-9-octadecenoic acid | (Z)-Octadec-9-enoic acid | CHEMBL8659 | OLEATE | Octadec-9-enoic acid | oleaic acid | oleicacid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H34O2 |
|---|
| Mol. Mass. | 282.4614 |
|---|
| SMILES | CCCCCCCC\C=C/CCCCCCCC(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
